Lineage for d3b6ra2 (3b6r A:103-381)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1925709Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1925710Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 1925843Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 1925901Protein automated matches [226885] (4 species)
    not a true protein
  7. 1925905Species Human (Homo sapiens) [TaxId:9606] [225066] (5 PDB entries)
  8. 1925906Domain d3b6ra2: 3b6r A:103-381 [208542]
    Other proteins in same PDB: d3b6ra1, d3b6rb1
    automated match to d1g0wa2
    complexed with act, adp, crn, mg, no3

Details for d3b6ra2

PDB Entry: 3b6r (more details), 2 Å

PDB Description: crystal structure of human brain-type creatine kinase
PDB Compounds: (A:) Creatine kinase B-type

SCOPe Domain Sequences for d3b6ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b6ra2 d.128.1.2 (A:103-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdehktdlnpdnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklaveal
ssldgdlagryyalksmteaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwvneedhlrvismqkggnmkevftrfctgltqietlfkskdyefmwnphlgyilt
cpsnlgtglragvhiklpnlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrl
gfsevelvqmvvdgvklliemeqrleqgqaiddlmpaqk

SCOPe Domain Coordinates for d3b6ra2:

Click to download the PDB-style file with coordinates for d3b6ra2.
(The format of our PDB-style files is described here.)

Timeline for d3b6ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b6ra1