![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins) automatically mapped to Pfam PF00217 |
![]() | Protein automated matches [226885] (7 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225066] (4 PDB entries) |
![]() | Domain d3b6ra2: 3b6r A:103-381 [208542] Other proteins in same PDB: d3b6ra1, d3b6rb1 automated match to d1g0wa2 complexed with act, adp, crn, mg, no3 |
PDB Entry: 3b6r (more details), 2 Å
SCOPe Domain Sequences for d3b6ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b6ra2 d.128.1.2 (A:103-381) automated matches {Human (Homo sapiens) [TaxId: 9606]} sdehktdlnpdnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklaveal ssldgdlagryyalksmteaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn ktflvwvneedhlrvismqkggnmkevftrfctgltqietlfkskdyefmwnphlgyilt cpsnlgtglragvhiklpnlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrl gfsevelvqmvvdgvklliemeqrleqgqaiddlmpaqk
Timeline for d3b6ra2: