Lineage for d3b6ra1 (3b6r A:6-102)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719234Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2719235Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2719300Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 2719301Protein automated matches [226884] (9 species)
    not a true protein
  7. 2719308Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries)
  8. 2719309Domain d3b6ra1: 3b6r A:6-102 [208541]
    Other proteins in same PDB: d3b6ra2, d3b6rb2
    automated match to d1g0wa1
    complexed with act, adp, crn, mg, no3

Details for d3b6ra1

PDB Entry: 3b6r (more details), 2 Å

PDB Description: crystal structure of human brain-type creatine kinase
PDB Compounds: (A:) Creatine kinase B-type

SCOPe Domain Sequences for d3b6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b6ra1 a.83.1.0 (A:6-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtgvdnpg
hpyimtvgcvagdeesyevfkdlfdpiiedrhggykp

SCOPe Domain Coordinates for d3b6ra1:

Click to download the PDB-style file with coordinates for d3b6ra1.
(The format of our PDB-style files is described here.)

Timeline for d3b6ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b6ra2