![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species) fat depleting factor related to class I MHC |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48966] (8 PDB entries) Uniprot P25311 22-294 |
![]() | Domain d1zagd1: 1zag D:184-276 [20854] Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2 complexed with nag, ndg |
PDB Entry: 1zag (more details), 2.8 Å
SCOPe Domain Sequences for d1zagd1:
Sequence, based on SEQRES records: (download)
>d1zagd1 b.1.1.2 (D:184-276) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq swvvvavppqdtapyschvqhsslaqplvvpwe
>d1zagd1 b.1.1.2 (D:184-276) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq swvvvayschvqhsslaqplvvpwe
Timeline for d1zagd1: