Lineage for d1zagd1 (1zag D:184-276)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 454586Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
    fat depleting factor related to class I MHC
  7. 454587Species Human (Homo sapiens) [TaxId:9606] [48966] (1 PDB entry)
  8. 454591Domain d1zagd1: 1zag D:184-276 [20854]
    Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2

Details for d1zagd1

PDB Entry: 1zag (more details), 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein

SCOP Domain Sequences for d1zagd1:

Sequence, based on SEQRES records: (download)

>d1zagd1 b.1.1.2 (D:184-276) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens)}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwe

Sequence, based on observed residues (ATOM records): (download)

>d1zagd1 b.1.1.2 (D:184-276) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens)}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvayschvqhsslaqplvvpwe

SCOP Domain Coordinates for d1zagd1:

Click to download the PDB-style file with coordinates for d1zagd1.
(The format of our PDB-style files is described here.)

Timeline for d1zagd1: