Lineage for d1zagd1 (1zag D:184-276)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 222043Protein Zinc-alpha-2-glycoprotein, ZAG [48965] (1 species)
    fat depleting factor related to MHC I
  7. 222044Species Human (Homo sapiens) [TaxId:9606] [48966] (1 PDB entry)
  8. 222048Domain d1zagd1: 1zag D:184-276 [20854]
    Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2
    complexed with gal, man, nag, sia

Details for d1zagd1

PDB Entry: 1zag (more details), 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein

SCOP Domain Sequences for d1zagd1:

Sequence, based on SEQRES records: (download)

>d1zagd1 b.1.1.2 (D:184-276) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens)}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwe

Sequence, based on observed residues (ATOM records): (download)

>d1zagd1 b.1.1.2 (D:184-276) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens)}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvayschvqhsslaqplvvpwe

SCOP Domain Coordinates for d1zagd1:

Click to download the PDB-style file with coordinates for d1zagd1.
(The format of our PDB-style files is described here.)

Timeline for d1zagd1: