SCOPe 2.03: Domain d3b4ya_: 3b4y A:

Lineage for d3b4ya_ (3b4y A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families)
   consists of clearly related families of somewhat different folds

5. Family c.1.16.0: automated matches [191510] (1 protein)
   not a true family

6. Protein automated matches [190849] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225443] (2 PDB entries)

8. Domain d3b4ya_: 3b4y A: [208534]
   automated match to d1rhca_
   complexed with f42, flc

Details for d3b4ya_

PDB Entry: 3b4y, 1.95 Å

PDB Description: FGD1 (Rv0407) from Mycobacterium tuberculosis

PDB Compounds: (A:) probable f420-dependent glucose-6-phosphate dehydrogenase fgd1

SCOPe Domain Sequences for d3b4ya_:

Sequence; same for both SEQRES and ATOM records:

>d3b4ya_ c.1.16.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
elklgykasaeqfaprelvelavaaeahgmdsatvsdhfqpwrhqgghapfslswmtavg
ertnrlllgtsvltptfrynpaviaqafatmgclypnrvflgvgtgealneiatgyegaw
pefkerfarlresvglmrqlwsgdrvdfdgdyyrlkgasiydvpdggvpvyiaaggpava
kyagragdgfictsgkgeelyteklmpavregaaaadrsvdgidkmieikisydpdpela
mnntrfwaplsltaeqkhsiddpiemekaadalpieqiakrwivasdpdeavekvgqyvt
wglnhlvfhapghdqrrflelfqsdlaprlrr

Timeline for d3b4ya_:

• d3b4ya_ is new in SCOPe 2.03-stable
  
• d3b4ya_ appears in SCOPe 2.04
  
• d3b4ya_ appears in the current release, SCOPe 2.08