Lineage for d1zagb1 (1zag B:184-278)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786962Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
    fat depleting factor related to class I MHC
  7. 786963Species Human (Homo sapiens) [TaxId:9606] [48966] (7 PDB entries)
    Uniprot P25311 22-294
  8. 786969Domain d1zagb1: 1zag B:184-278 [20852]
    Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2

Details for d1zagb1

PDB Entry: 1zag (more details), 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein
PDB Compounds: (B:) protein (zinc-alpha-2-glycoprotein)

SCOP Domain Sequences for d1zagb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zagb1 b.1.1.2 (B:184-278) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpweas

SCOP Domain Coordinates for d1zagb1:

Click to download the PDB-style file with coordinates for d1zagb1.
(The format of our PDB-style files is described here.)

Timeline for d1zagb1: