Lineage for d1zagb1 (1zag B:184-278)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 104662Protein Zinc-alpha-2-glycoprotein, ZAG [48965] (1 species)
  7. 104663Species Human (Homo sapiens) [TaxId:9606] [48966] (1 PDB entry)
  8. 104665Domain d1zagb1: 1zag B:184-278 [20852]
    Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2

Details for d1zagb1

PDB Entry: 1zag (more details), 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein

SCOP Domain Sequences for d1zagb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zagb1 b.1.1.2 (B:184-278) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens)}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpweas

SCOP Domain Coordinates for d1zagb1:

Click to download the PDB-style file with coordinates for d1zagb1.
(The format of our PDB-style files is described here.)

Timeline for d1zagb1: