Lineage for d3b4mc_ (3b4m C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415602Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1416109Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1416110Protein automated matches [190896] (3 species)
    not a true protein
  7. 1416117Species Human (Homo sapiens) [TaxId:9606] [188315] (18 PDB entries)
  8. 1416160Domain d3b4mc_: 3b4m C: [208519]
    automated match to d2cpea1

Details for d3b4mc_

PDB Entry: 3b4m (more details), 2.82 Å

PDB Description: Crystal Structure of Human PABPN1 RRM
PDB Compounds: (C:) Polyadenylate-binding protein 2

SCOPe Domain Sequences for d3b4mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b4mc_ d.58.7.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrt
slaldeslfrgrqikvipkr

SCOPe Domain Coordinates for d3b4mc_:

Click to download the PDB-style file with coordinates for d3b4mc_.
(The format of our PDB-style files is described here.)

Timeline for d3b4mc_: