![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Zinc-alpha-2-glycoprotein, ZAG [48965] (1 species) fat depleting factor related to MHC I |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48966] (1 PDB entry) |
![]() | Domain d1zaga1: 1zag A:184-277 [20851] Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2 |
PDB Entry: 1zag (more details), 2.8 Å
SCOP Domain Sequences for d1zaga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zaga1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens)} qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq swvvvavppqdtapyschvqhsslaqplvvpwea
Timeline for d1zaga1: