Lineage for d3b1ed_ (3b1e D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380996Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1380997Protein automated matches [190151] (66 species)
    not a true protein
  7. 1381322Species Streptococcus anginosus [TaxId:1328] [195061] (3 PDB entries)
  8. 1381330Domain d3b1ed_: 3b1e D: [208503]
    automated match to d3b1cc_
    complexed with act, epe, na, p1t

Details for d3b1ed_

PDB Entry: 3b1e (more details), 1.78 Å

PDB Description: crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: alpha-aminoacrylate form
PDB Compounds: (D:) BetaC-S lyase

SCOPe Domain Sequences for d3b1ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b1ed_ c.67.1.0 (D:) automated matches {Streptococcus anginosus [TaxId: 1328]}
ynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygytya
sdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvyppfa
rsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerevle
qighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagtkn
syaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqfav
eyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsegelh
arlniaapkslveeickrivcclpk

SCOPe Domain Coordinates for d3b1ed_:

Click to download the PDB-style file with coordinates for d3b1ed_.
(The format of our PDB-style files is described here.)

Timeline for d3b1ed_: