SCOPe 2.05: Domain d3b1eb_: 3b1e B:

Lineage for d3b1eb_ (3b1e B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (98 species)
   not a true protein

7. Species Streptococcus anginosus [TaxId:1328] [195061] (3 PDB entries)

8. Domain d3b1eb_: 3b1e B: [208501]
   automated match to d3b1cc_
   complexed with act, epe, na, p1t

Details for d3b1eb_

PDB Entry: 3b1e, 1.78 Å

PDB Description: crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: alpha-aminoacrylate form

PDB Compounds: (B:) BetaC-S lyase

SCOPe Domain Sequences for d3b1eb_:

Sequence; same for both SEQRES and ATOM records:

>d3b1eb_ c.67.1.0 (B:) automated matches {Streptococcus anginosus [TaxId: 1328]}
skynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygyt
yasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvypp
farsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerev
leqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagt
knsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqf
aveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsege
lharlniaapkslveeickrivcclpk

Timeline for d3b1eb_:

• d3b1eb_ first appeared in SCOPe 2.03
  
• d3b1eb_ appears in SCOPe 2.04
  
• d3b1eb_ appears in SCOPe 2.06
  
• d3b1eb_ appears in the current release, SCOPe 2.08