Lineage for d1ed3e_ (1ed3 E:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548300Protein beta2-microglobulin [88600] (4 species)
  7. 548545Species Rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries)
  8. 548551Domain d1ed3e_: 1ed3 E: [20850]
    Other proteins in same PDB: d1ed3a1, d1ed3a2, d1ed3d1, d1ed3d2

Details for d1ed3e_

PDB Entry: 1ed3 (more details), 2.55 Å

PDB Description: crystal structure of rat minor histocompatibility antigen complex rt1- aa/mtf-e.

SCOP Domain Sequences for d1ed3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ed3e_ b.1.1.2 (E:) beta2-microglobulin {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOP Domain Coordinates for d1ed3e_:

Click to download the PDB-style file with coordinates for d1ed3e_.
(The format of our PDB-style files is described here.)

Timeline for d1ed3e_: