| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein beta2-microglobulin [88600] (7 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries) |
| Domain d1ed3e_: 1ed3 E: [20850] Other proteins in same PDB: d1ed3a1, d1ed3a2, d1ed3d1, d1ed3d2 |
PDB Entry: 1ed3 (more details), 2.55 Å
SCOPe Domain Sequences for d1ed3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ed3e_ b.1.1.2 (E:) beta2-microglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
Timeline for d1ed3e_: