Lineage for d3b1dd_ (3b1d D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2149303Species Streptococcus anginosus [TaxId:1328] [195061] (3 PDB entries)
  8. 2149307Domain d3b1dd_: 3b1d D: [208499]
    automated match to d3b1cc_
    complexed with epe, na, plp, pls

Details for d3b1dd_

PDB Entry: 3b1d (more details), 1.66 Å

PDB Description: crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: external aldimine form
PDB Compounds: (D:) BetaC-S lyase

SCOPe Domain Sequences for d3b1dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b1dd_ c.67.1.0 (D:) automated matches {Streptococcus anginosus [TaxId: 1328]}
kynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygyty
asdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvyppf
arsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerevl
eqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagtk
nsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqfa
veyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsegel
harlniaapkslveeickrivcclpk

SCOPe Domain Coordinates for d3b1dd_:

Click to download the PDB-style file with coordinates for d3b1dd_.
(The format of our PDB-style files is described here.)

Timeline for d3b1dd_: