![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Streptococcus anginosus [TaxId:1328] [195061] (3 PDB entries) |
![]() | Domain d3b1dc_: 3b1d C: [208498] automated match to d3b1cc_ complexed with epe, na, plp, pls |
PDB Entry: 3b1d (more details), 1.66 Å
SCOPe Domain Sequences for d3b1dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b1dc_ c.67.1.0 (C:) automated matches {Streptococcus anginosus [TaxId: 1328]} kynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygyty asdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvyppf arsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerevl eqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagtk nsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqfa veyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsegel harlniaapkslveeickrivcclpk
Timeline for d3b1dc_: