Lineage for d3aztd_ (3azt D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095991Species Thermotoga maritima [TaxId:243274] [226181] (7 PDB entries)
  8. 2096003Domain d3aztd_: 3azt D: [208495]
    automated match to d1ceca_

Details for d3aztd_

PDB Entry: 3azt (more details), 1.8 Å

PDB Description: diverse substrates recognition mechanism revealed by thermotoga maritima cel5a structures in complex with cellotetraose
PDB Compounds: (D:) endoglucanase

SCOPe Domain Sequences for d3aztd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aztd_ c.1.8.0 (D:) automated matches {Thermotoga maritima [TaxId: 243274]}
mgvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwstha
yafppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiad
rykdypetlffeilnephgnltpekwnelleealkvirsidkkhtiiigtaewggisale
klsvpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfiee
wskknkrpiyigafgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrk
twnkdlleali

SCOPe Domain Coordinates for d3aztd_:

Click to download the PDB-style file with coordinates for d3aztd_.
(The format of our PDB-style files is described here.)

Timeline for d3aztd_: