Lineage for d3aztb_ (3azt B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820797Species Thermotoga maritima [TaxId:243274] [226181] (7 PDB entries)
  8. 1820807Domain d3aztb_: 3azt B: [208493]
    automated match to d1ceca_

Details for d3aztb_

PDB Entry: 3azt (more details), 1.8 Å

PDB Description: diverse substrates recognition mechanism revealed by thermotoga maritima cel5a structures in complex with cellotetraose
PDB Compounds: (B:) endoglucanase

SCOPe Domain Sequences for d3aztb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aztb_ c.1.8.0 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
dpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthayaf
ppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadryk
dypetlffeilnephgnltpekwnelleealkvirsidkkhtiiigtaewggisalekls
vpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfieewsk
knkrpiyigafgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrktwn
kdlleali

SCOPe Domain Coordinates for d3aztb_:

Click to download the PDB-style file with coordinates for d3aztb_.
(The format of our PDB-style files is described here.)

Timeline for d3aztb_: