Lineage for d3azsa_ (3azs A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (93 species)
    not a true protein
  7. 2419528Species Thermotoga maritima [TaxId:243274] [226181] (7 PDB entries)
  8. 2419533Domain d3azsa_: 3azs A: [208490]
    automated match to d1ceca_

Details for d3azsa_

PDB Entry: 3azs (more details), 1.69 Å

PDB Description: Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d3azsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azsa_ c.1.8.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
dpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthayaf
ppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadryk
dypetlffeilnephgnltpekwnelleealkvirsidkkhtiiigtaewggisalekls
vpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfieewsk
knkrpiyigafgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrktwn
kdlleali

SCOPe Domain Coordinates for d3azsa_:

Click to download the PDB-style file with coordinates for d3azsa_.
(The format of our PDB-style files is described here.)

Timeline for d3azsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3azsb_