SCOPe 2.08: Domain d3azsa_: 3azs A:

Lineage for d3azsa_ (3azs A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [226181] (7 PDB entries)

8. Domain d3azsa_: 3azs A: [208490]
   automated match to d1ceca_

Details for d3azsa_

PDB Entry: 3azs, 1.69 Å

PDB Description: diverse substrates recognition mechanism revealed by thermotoga maritima cel5a structures in complex with mannotriose

PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d3azsa_:

Sequence; same for both SEQRES and ATOM records:

>d3azsa_ c.1.8.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
dpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthayaf
ppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadryk
dypetlffeilnephgnltpekwnelleealkvirsidkkhtiiigtaewggisalekls
vpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfieewsk
knkrpiyigafgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrktwn
kdlleali

Timeline for d3azsa_:

• d3azsa_ first appeared in SCOPe 2.03
  
• d3azsa_ appears in SCOPe 2.07