Lineage for d1ed3d1 (1ed3 D:182-275)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654844Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [88607] (3 PDB entries)
  8. 654847Domain d1ed3d1: 1ed3 D:182-275 [20849]
    Other proteins in same PDB: d1ed3a2, d1ed3b_, d1ed3d2, d1ed3e_

Details for d1ed3d1

PDB Entry: 1ed3 (more details), 2.55 Å

PDB Description: crystal structure of rat minor histocompatibility antigen complex rt1- aa/mtf-e.
PDB Compounds: (D:) class I major histocompatibility antigen rt1-aa

SCOP Domain Sequences for d1ed3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ed3d1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Rat (Rattus norvegicus), RT1-AA [TaxId: 10116]}
sdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrveheglpkplsqrwe

SCOP Domain Coordinates for d1ed3d1:

Click to download the PDB-style file with coordinates for d1ed3d1.
(The format of our PDB-style files is described here.)

Timeline for d1ed3d1: