Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [88607] (3 PDB entries) |
Domain d1ed3d1: 1ed3 D:182-275 [20849] Other proteins in same PDB: d1ed3a2, d1ed3b_, d1ed3d2, d1ed3e_ |
PDB Entry: 1ed3 (more details), 2.55 Å
SCOP Domain Sequences for d1ed3d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ed3d1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Rat (Rattus norvegicus), RT1-AA [TaxId: 10116]} sdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrveheglpkplsqrwe
Timeline for d1ed3d1:
View in 3D Domains from other chains: (mouse over for more information) d1ed3a1, d1ed3a2, d1ed3b_, d1ed3e_ |