Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries) |
Domain d1ed3b_: 1ed3 B: [20848] Other proteins in same PDB: d1ed3a1, d1ed3a2, d1ed3d1, d1ed3d2 |
PDB Entry: 1ed3 (more details), 2.55 Å
SCOP Domain Sequences for d1ed3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ed3b_ b.1.1.2 (B:) beta2-microglobulin {Rat (Rattus norvegicus) [TaxId: 10116]} iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
Timeline for d1ed3b_: