Lineage for d1ed3b_ (1ed3 B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220725Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [48964] (3 PDB entries)
  8. 220729Domain d1ed3b_: 1ed3 B: [20848]
    Other proteins in same PDB: d1ed3a2, d1ed3d2

Details for d1ed3b_

PDB Entry: 1ed3 (more details), 2.55 Å

PDB Description: crystal structure of rat minor histocompatibility antigen complex rt1- aa/mtf-e.

SCOP Domain Sequences for d1ed3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ed3b_ b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Rat (Rattus norvegicus), RT1-AA}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOP Domain Coordinates for d1ed3b_:

Click to download the PDB-style file with coordinates for d1ed3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ed3b_: