Lineage for d1ed3a1 (1ed3 A:182-275)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932656Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 933026Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [88607] (3 PDB entries)
  8. 933029Domain d1ed3a1: 1ed3 A:182-275 [20847]
    Other proteins in same PDB: d1ed3a2, d1ed3b_, d1ed3d2, d1ed3e_

Details for d1ed3a1

PDB Entry: 1ed3 (more details), 2.55 Å

PDB Description: crystal structure of rat minor histocompatibility antigen complex rt1- aa/mtf-e.
PDB Compounds: (A:) class I major histocompatibility antigen rt1-aa

SCOPe Domain Sequences for d1ed3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ed3a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Rat (Rattus norvegicus), RT1-AA [TaxId: 10116]}
sdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrveheglpkplsqrwe

SCOPe Domain Coordinates for d1ed3a1:

Click to download the PDB-style file with coordinates for d1ed3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ed3a1: