SCOPe 2.07: Domain d1ddhb_: 1ddh B:

Lineage for d1ddhb_ (1ddh B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1ddhb_: 1ddh B: [20846]
   Other proteins in same PDB: d1ddha1, d1ddha2

Details for d1ddhb_

PDB Entry: 1ddh, 3.1 Å

PDB Description: mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and an immunodominant peptide p18-i10 from the human immunodeficiency virus envelope glycoprotein 120

PDB Compounds: (B:) beta-2 microglobulin

SCOPe Domain Sequences for d1ddhb_:

Sequence; same for both SEQRES and ATOM records:

>d1ddhb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
mqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhasmaepktvywdrdm

Timeline for d1ddhb_:

• d1ddhb_ first appeared (with stable ids) in SCOP 1.55, called d1ddhb1
  
• d1ddhb_ appears in SCOPe 2.06
  
• d1ddhb_ appears in the current release, SCOPe 2.08