Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.6: FabZ-like [110902] (1 protein) automatically mapped to Pfam PF07977 |
Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143186] (8 PDB entries) Uniprot Q965D7 84-229! Uniprot Q965D7 94-229 |
Domain d3azax_: 3aza X: [208459] automated match to d1z6ba1 complexed with gol, km0 |
PDB Entry: 3aza (more details), 2.7 Å
SCOPe Domain Sequences for d3azax_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3azax_ d.38.1.6 (X:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg iaklsgvgyvngkvvinisemtfals
Timeline for d3azax_: