SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3azaf_ (3aza F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167645Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2167646Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2168139Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 2168140Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 2168238Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143186] (8 PDB entries)
    Uniprot Q965D7 84-229! Uniprot Q965D7 94-229
  8. 2168276Domain d3azaf_: 3aza F: [208441]
    automated match to d1z6ba1
    complexed with gol, km0

Details for d3azaf_

PDB Entry: 3aza (more details), 2.7 Å

PDB Description: Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Plasmodium falciparum in complex with NAS91-10
PDB Compounds: (F:) Beta-hydroxyacyl-ACP dehydratase

SCOPe Domain Sequences for d3azaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azaf_ d.38.1.6 (F:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
iaklsgvgyvngkvvinisemtfals

SCOPe Domain Coordinates for d3azaf_:

Click to download the PDB-style file with coordinates for d3azaf_.
(The format of our PDB-style files is described here.)

Timeline for d3azaf_: