Lineage for d1biib_ (1bii B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220640Species Mouse (Mus musculus), H-2DD [TaxId:10090] [48963] (3 PDB entries)
  8. 220644Domain d1biib_: 1bii B: [20844]
    Other proteins in same PDB: d1biia2

Details for d1biib_

PDB Entry: 1bii (more details), 2.4 Å

PDB Description: the crystal structure of h-2dd mhc class i in complex with the hiv-1 derived peptide p18-110
PDB Compounds: (B:)

SCOP Domain Sequences for d1biib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1biib_ b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DD}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1biib_:

Click to download the PDB-style file with coordinates for d1biib_.
(The format of our PDB-style files is described here.)

Timeline for d1biib_: