Lineage for d1biib1 (1bii B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 53086Species Mouse (Mus musculus), H-2DD [TaxId:10090] [48963] (3 PDB entries)
  8. 53090Domain d1biib1: 1bii B: [20844]
    Other proteins in same PDB: d1biia2

Details for d1biib1

PDB Entry: 1bii (more details), 2.4 Å

PDB Description: the crystal structure of h-2dd mhc class i in complex with the hiv-1 derived peptide p18-110

SCOP Domain Sequences for d1biib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1biib1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DD}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1biib1:

Click to download the PDB-style file with coordinates for d1biib1.
(The format of our PDB-style files is described here.)

Timeline for d1biib1: