SCOPe 2.06: Domain d3ay9a2: 3ay9 A:189-382

Lineage for d3ay9a2 (3ay9 A:189-382)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225574] (46 PDB entries)

8. Domain d3ay9a2: 3ay9 A:189-382 [208431]
   automated match to d1ngfa2
   complexed with adp, ca, cl, k, mg, po4

Details for d3ay9a2

PDB Entry: 3ay9, 1.75 Å

PDB Description: Crystal structure of human Hsp70 NBD in the ADP-, Mg ion-, and K ion-bound state

PDB Compounds: (A:) Heat shock 70 kDa protein 1A/1B

SCOPe Domain Sequences for d3ay9a2:

Sequence; same for both SEQRES and ATOM records:

>d3ay9a2 c.55.1.1 (A:189-382) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk
hkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcsd
lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea
vaygaavqaailmg

Timeline for d3ay9a2:

• d3ay9a2 first appeared in SCOPe 2.03
  
• d3ay9a2 appears in SCOPe 2.05
  
• d3ay9a2 appears in SCOPe 2.07
  
• d3ay9a2 appears in the current release, SCOPe 2.08