Lineage for d1biia1 (1bii A:182-274)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932656Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 932877Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 932989Domain d1biia1: 1bii A:182-274 [20843]
    Other proteins in same PDB: d1biia2, d1biib_

Details for d1biia1

PDB Entry: 1bii (more details), 2.4 Å

PDB Description: the crystal structure of h-2dd mhc class i in complex with the hiv-1 derived peptide p18-110
PDB Compounds: (A:) MHC class I h-2dd

SCOPe Domain Sequences for d1biia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1biia1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdppkahvthhrrpegdvtlrcwalgfypaditltwqlngeeltqemelvetrpagdgtf
qkwasvvvplgkeqkytchveheglpepltlrw

SCOPe Domain Coordinates for d1biia1:

Click to download the PDB-style file with coordinates for d1biia1.
(The format of our PDB-style files is described here.)

Timeline for d1biia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1biia2
View in 3D
Domains from other chains:
(mouse over for more information)
d1biib_