SCOPe 2.05: Domain d3ay4c2: 3ay4 C:87-174

Lineage for d3ay4c2 (3ay4 C:87-174)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (27 PDB entries)

8. Domain d3ay4c2: 3ay4 C:87-174 [208427]
   Other proteins in same PDB: d3ay4a1, d3ay4a2, d3ay4b1, d3ay4b2
   automated match to d1fnla2

Details for d3ay4c2

PDB Entry: 3ay4, 2.2 Å

PDB Description: crystal structure of nonfucosylated fc complexed with bis-glycosylated soluble form of fc gamma receptor iiia

PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor III-A

SCOPe Domain Sequences for d3ay4c2:

Sequence; same for both SEQRES and ATOM records:

>d3ay4c2 b.1.1.4 (C:87-174) automated matches {Human (Homo sapiens) [TaxId: 9606]}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkgrkyfhhnsdfyipkatl
kdsgsyfcrglvgsknvssetvqititq

Timeline for d3ay4c2:

• d3ay4c2 first appeared in SCOPe 2.03
  
• d3ay4c2 appears in SCOPe 2.04
  
• d3ay4c2 appears in SCOPe 2.06
  
• d3ay4c2 appears in the current release, SCOPe 2.08