Lineage for d3ay4c1 (3ay4 C:5-86)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2354769Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2355180Protein automated matches [190803] (2 species)
    not a true protein
  7. 2355181Species Human (Homo sapiens) [TaxId:9606] [188070] (27 PDB entries)
  8. 2355202Domain d3ay4c1: 3ay4 C:5-86 [208426]
    Other proteins in same PDB: d3ay4a1, d3ay4a2, d3ay4b1, d3ay4b2
    automated match to d1fnla1

Details for d3ay4c1

PDB Entry: 3ay4 (more details), 2.2 Å

PDB Description: Crystal structure of nonfucosylated Fc complexed with bis-glycosylated soluble form of Fc gamma receptor IIIa
PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor III-A

SCOPe Domain Sequences for d3ay4c1:

Sequence, based on SEQRES records: (download)

>d3ay4c1 b.1.1.4 (C:5-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvd
dsgeyrcqtqlstlsdpvqlev

Sequence, based on observed residues (ATOM records): (download)

>d3ay4c1 b.1.1.4 (C:5-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpkavvflepqwyrvlekdsvtlkcqqwfhneslissqassyfidaatvddsgeyrcqtq
lstlsdpvqlev

SCOPe Domain Coordinates for d3ay4c1:

Click to download the PDB-style file with coordinates for d3ay4c1.
(The format of our PDB-style files is described here.)

Timeline for d3ay4c1: