Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (174 PDB entries) Uniprot P01887 |
Domain d1qo3b_: 1qo3 B: [20842] Other proteins in same PDB: d1qo3a1, d1qo3a2, d1qo3c_, d1qo3d_ complexed with edo |
PDB Entry: 1qo3 (more details), 2.3 Å
SCOPe Domain Sequences for d1qo3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qo3b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd wsfyilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d1qo3b_:
View in 3D Domains from other chains: (mouse over for more information) d1qo3a1, d1qo3a2, d1qo3c_, d1qo3d_ |