![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
![]() | Species Mouse (Mus musculus), H-2DD [TaxId:10090] [48963] (3 PDB entries) |
![]() | Domain d1qo3b1: 1qo3 B: [20842] Other proteins in same PDB: d1qo3a2, d1qo3c_, d1qo3d_ |
PDB Entry: 1qo3 (more details), 2.3 Å
SCOP Domain Sequences for d1qo3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qo3b1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DD} miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd wsfyilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d1qo3b1:
![]() Domains from other chains: (mouse over for more information) d1qo3a1, d1qo3a2, d1qo3c_, d1qo3d_ |