Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d3axlg1: 3axl G:3-129 [208418] Other proteins in same PDB: d3axla2, d3axlb2, d3axlg2, d3axlh2 automated match to d1qrnd1 |
PDB Entry: 3axl (more details), 2.9 Å
SCOPe Domain Sequences for d3axlg1:
Sequence, based on SEQRES records: (download)
>d3axlg1 b.1.1.0 (G:3-129) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qveqspaslvlqegenaelqctysttlnsmqwfyqrpggrlvsllyspswaeqrggrlts saasnesrsslhisssqitdsgtylcaiasssfsklvfgqgtslsvvpn
>d3axlg1 b.1.1.0 (G:3-129) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qveqspaslvlqegenaelqctysttlnsmqwfyqrpggrlvsllyspseqrggrltssa asnesrsslhisssqitdsgtylcaiasssfsklvfgqgtslsvvpn
Timeline for d3axlg1: