SCOPe 2.08: Domain d3axla2: 3axl A:130-218

Lineage for d3axla2 (3axl A:130-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3axla2: 3axl A:130-218 [208415]
   Other proteins in same PDB: d3axla1, d3axlb1, d3axlg1, d3axlh1
   automated match to d1qrnd2

Details for d3axla2

PDB Entry: 3axl, 2.9 Å

PDB Description: Murine Valpha 10 Vbeta 8.1 T-cell receptor

PDB Compounds: (A:) Valpha 10

SCOPe Domain Sequences for d3axla2:

Sequence, based on SEQRES records:

>d3axla2 b.1.1.2 (A:130-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d3axla2 b.1.1.2 (A:130-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
sdfacanafnnsiipedtffps

Timeline for d3axla2:

• d3axla2 first appeared in SCOPe 2.03
  
• d3axla2 appears in SCOPe 2.07