Lineage for d3axla1 (3axl A:3-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760900Domain d3axla1: 3axl A:3-129 [208414]
    Other proteins in same PDB: d3axla2, d3axlb2, d3axlg2, d3axlh2
    automated match to d1qrnd1

Details for d3axla1

PDB Entry: 3axl (more details), 2.9 Å

PDB Description: Murine Valpha 10 Vbeta 8.1 T-cell receptor
PDB Compounds: (A:) Valpha 10

SCOPe Domain Sequences for d3axla1:

Sequence, based on SEQRES records: (download)

>d3axla1 b.1.1.0 (A:3-129) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qveqspaslvlqegenaelqctysttlnsmqwfyqrpggrlvsllyspswaeqrggrlts
saasnesrsslhisssqitdsgtylcaiasssfsklvfgqgtslsvvpn

Sequence, based on observed residues (ATOM records): (download)

>d3axla1 b.1.1.0 (A:3-129) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qveqspaslvlqegenaelqctysttlnsmqwfyqrpggrlvsllyeqrggrltssaasr
sslhisssqitdsgtylcaiasssfsklvfgqgtslsvvpn

SCOPe Domain Coordinates for d3axla1:

Click to download the PDB-style file with coordinates for d3axla1.
(The format of our PDB-style files is described here.)

Timeline for d3axla1: