![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily) beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops |
![]() | Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) ![]() duplication: consists of 4 structural repeats arranged in 2 lobes contains one left-hand beta-alpha-beta unit per lobe automatically mapped to Pfam PF02738 |
![]() | Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins) |
![]() | Protein Xanthine oxidase, C-terminal domain [56008] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56009] (11 PDB entries) Uniprot P80457 |
![]() | Domain d3ax9b4: 3ax9 B:695-1319 [208413] Other proteins in same PDB: d3ax9a1, d3ax9a2, d3ax9a3, d3ax9a5, d3ax9a6, d3ax9b1, d3ax9b2, d3ax9b3, d3ax9b5, d3ax9b6 automated match to d1v97a5 complexed with bct, ca, fad, fes, gol, sal, xax |
PDB Entry: 3ax9 (more details), 2.3 Å
SCOPe Domain Sequences for d3ax9b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ax9b4 d.133.1.1 (B:695-1319) Xanthine oxidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf rldspatpekirnacvdkfttlcvt
Timeline for d3ax9b4: