Class a: All alpha proteins [46456] (289 folds) |
Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) contains 2Fe-2S cluster |
Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins) |
Protein Xanthine oxidase, domain 2 [47746] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries) Uniprot P80457 |
Domain d3ax9b2: 3ax9 B:93-165 [208411] Other proteins in same PDB: d3ax9a1, d3ax9a3, d3ax9a4, d3ax9a5, d3ax9a6, d3ax9b1, d3ax9b3, d3ax9b4, d3ax9b5, d3ax9b6 automated match to d1v97a1 complexed with bct, ca, fad, fes, gol, sal, xax |
PDB Entry: 3ax9 (more details), 2.3 Å
SCOPe Domain Sequences for d3ax9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ax9b2 a.56.1.1 (B:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]} stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg yrpilqgfrtfak
Timeline for d3ax9b2: