Lineage for d3ax9b1 (3ax9 B:2-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934134Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 2934135Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries)
    Uniprot P80457
  8. 2934151Domain d3ax9b1: 3ax9 B:2-92 [208410]
    Other proteins in same PDB: d3ax9a2, d3ax9a3, d3ax9a4, d3ax9a5, d3ax9a6, d3ax9b2, d3ax9b3, d3ax9b4, d3ax9b5, d3ax9b6
    automated match to d1v97a2
    complexed with bct, ca, fad, fes, gol, sal, xax

Details for d3ax9b1

PDB Entry: 3ax9 (more details), 2.3 Å

PDB Description: Bovine xanthone oxidase, protease cleaved form
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3ax9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ax9b1 d.15.4.2 (B:2-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3ax9b1:

Click to download the PDB-style file with coordinates for d3ax9b1.
(The format of our PDB-style files is described here.)

Timeline for d3ax9b1: