Lineage for d1qo3a1 (1qo3 A:182-275)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220640Species Mouse (Mus musculus), H-2DD [TaxId:10090] [48963] (3 PDB entries)
  8. 220641Domain d1qo3a1: 1qo3 A:182-275 [20841]
    Other proteins in same PDB: d1qo3a2, d1qo3c_, d1qo3d_

Details for d1qo3a1

PDB Entry: 1qo3 (more details), 2.3 Å

PDB Description: complex between nk cell receptor ly49a and its mhc class i ligand h-2dd

SCOP Domain Sequences for d1qo3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo3a1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DD}
tdppkahvthhrrpegdvtlrcwalgfypaditltwqlngeeltqemelvetrpagdgtf
qkwasvvvplgkeqkytchveheglpepltlrwg

SCOP Domain Coordinates for d1qo3a1:

Click to download the PDB-style file with coordinates for d1qo3a1.
(The format of our PDB-style files is described here.)

Timeline for d1qo3a1: