SCOPe 2.03: Domain d3ax7a3: 3ax7 A:415-528

Lineage for d3ax7a3 (3ax7 A:415-528)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)

6. Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55453] (11 PDB entries)
   Uniprot P80457

8. Domain d3ax7a3: 3ax7 A:415-528 [208400]
   Other proteins in same PDB: d3ax7a1, d3ax7a2, d3ax7a4, d3ax7b1, d3ax7b2, d3ax7b4
   automated match to d1v97a4
   complexed with bct, ca, fad, fes, gol, sal, xax

Details for d3ax7a3

PDB Entry: 3ax7, 2.34 Å

PDB Description: Bovine Xanthine Oxidase, protease cleaved form

PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3ax7a3:

Sequence; same for both SEQRES and ATOM records:

>d3ax7a3 d.87.2.1 (A:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

Timeline for d3ax7a3:

• d3ax7a3 is new in SCOPe 2.03-stable
  
• d3ax7a3 appears in SCOPe 2.04
  
• d3ax7a3 appears in the current release, SCOPe 2.08