SCOP 1.73: Domain d1ldpl_: 1ldp L:

Lineage for d1ldpl_ (1ldp L:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)

8. Domain d1ldpl_: 1ldp L: [20840]
   Other proteins in same PDB: d1ldph1, d1ldph2
   complexed with nag; mutant

Details for d1ldpl_

PDB Entry: 1ldp, 3.1 Å

PDB Description: crystal structure of murine mhc class i h-2ld with a mixture of bound peptides

PDB Compounds: (L:) MHC class I h-2ld

SCOP Domain Sequences for d1ldpl_:

Sequence; same for both SEQRES and ATOM records:

>d1ldpl_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1ldpl_:

• d1ldpl_ first appeared (with stable ids) in SCOP 1.55, called d1ldpl1
  
• d1ldpl_ appears in SCOP 1.71
  
• d1ldpl_ appears in SCOP 1.75
  
• d1ldpl_ appears in the current release, SCOPe 2.08