Lineage for d1ldpl1 (1ldp L:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 53132Species Mouse (Mus musculus), H-2LD [TaxId:10090] [48962] (2 PDB entries)
  8. 53138Domain d1ldpl1: 1ldp L: [20840]
    Other proteins in same PDB: d1ldph2

Details for d1ldpl1

PDB Entry: 1ldp (more details), 3.1 Å

PDB Description: crystal structure of murine mhc class i h-2ld with a mixture of bound peptides
PDB Compounds: (L:)

SCOP Domain Sequences for d1ldpl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldpl1 b.1.1.2 (L:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2LD}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1ldpl1:

Click to download the PDB-style file with coordinates for d1ldpl1.
(The format of our PDB-style files is described here.)

Timeline for d1ldpl1: