Lineage for d1ldpl1 (1ldp L:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) 
Species Mouse (Mus musculus), H-2LD [TaxId:10090] [48962] (2 PDB entries) 
Domain d1ldpl1: 1ldp L: [20840]
Other proteins in same PDB: d1ldph2
Details for d1ldpl1
PDB Entry: 1ldp (more details), 3.1 Å
PDB Description: crystal structure of murine mhc class i h-2ld with a mixture of bound peptides
SCOP Domain Sequences for d1ldpl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldpl1 b.1.1.2 (L:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2LD}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
SCOP Domain Coordinates for d1ldpl1:
Click to download the PDB-style file with coordinates for d1ldpl1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ldpl1:
- d1ldpl1 appears in SCOP 1.57
- d1ldpl1 appears in the current release, SCOPe 2.08, called d1ldpl_
View in 3D
