Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (45 species) not a true protein |
Species Huperzia serrata [TaxId:355589] [226198] (2 PDB entries) |
Domain d3awka2: 3awk A:246-399 [208397] automated match to d1bi5a2 complexed with gol, so4 |
PDB Entry: 3awk (more details), 2 Å
SCOPe Domain Sequences for d3awka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3awka2 c.95.1.0 (A:246-399) automated matches {Huperzia serrata [TaxId: 355589]} lfeihwageavlpdsdgainghlreaglifhllkdvpglisknidkvlaepleyvhfpsy ndmfwavhpggpaildqieaklglstdkmqasrdvlasygnmssasvlfvldqirknsee lhlpttgegfewgfvigfgpgltvetlllrsini
Timeline for d3awka2: