Lineage for d3awjb1 (3awj B:20-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917752Species Huperzia serrata [TaxId:355589] [226198] (2 PDB entries)
  8. 2917757Domain d3awjb1: 3awj B:20-245 [208394]
    automated match to d1cmla1
    complexed with coa, so4

Details for d3awjb1

PDB Entry: 3awj (more details), 2.2 Å

PDB Description: Crystal structure of the Huperzia serrata polyketide synthase 1 complexed with CoA-SH
PDB Compounds: (B:) Chalcone synthase-like polyketide synthase

SCOPe Domain Sequences for d3awjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3awjb1 c.95.1.0 (B:20-245) automated matches {Huperzia serrata [TaxId: 355589]}
vikpdgpatilaigtsnptnifeqstypdfffdvtncndktelkkkfqricdksgikkrh
fhltdeilrknpsickfkeasldprqdiavlevpklakeaaisaikqwgqpkskithlvf
attsgvdmpgadfqlakllglrptvkrvmlyqqgcyagatvlrvakdlaennkgarvlva
csevtavtfrapsethldglvgsalfgdgaaalivgsdpvpqeekp

SCOPe Domain Coordinates for d3awjb1:

Click to download the PDB-style file with coordinates for d3awjb1.
(The format of our PDB-style files is described here.)

Timeline for d3awjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3awjb2