![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Huperzia serrata [TaxId:355589] [226198] (2 PDB entries) |
![]() | Domain d3awjb1: 3awj B:20-245 [208394] automated match to d1cmla1 complexed with coa, so4 |
PDB Entry: 3awj (more details), 2.2 Å
SCOPe Domain Sequences for d3awjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3awjb1 c.95.1.0 (B:20-245) automated matches {Huperzia serrata [TaxId: 355589]} vikpdgpatilaigtsnptnifeqstypdfffdvtncndktelkkkfqricdksgikkrh fhltdeilrknpsickfkeasldprqdiavlevpklakeaaisaikqwgqpkskithlvf attsgvdmpgadfqlakllglrptvkrvmlyqqgcyagatvlrvakdlaennkgarvlva csevtavtfrapsethldglvgsalfgdgaaalivgsdpvpqeekp
Timeline for d3awjb1: