SCOP 1.73: Domain d1ldph1: 1ldp H:182-272

Lineage for d1ldph1 (1ldp H:182-272)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)

8. Domain d1ldph1: 1ldp H:182-272 [20839]
   Other proteins in same PDB: d1ldph2, d1ldpl_
   complexed with nag; mutant

Details for d1ldph1

PDB Entry: 1ldp, 3.1 Å

PDB Description: crystal structure of murine mhc class i h-2ld with a mixture of bound peptides

PDB Compounds: (H:) MHC class I h-2ld

SCOP Domain Sequences for d1ldph1:

Sequence; same for both SEQRES and ATOM records:

>d1ldph1 b.1.1.2 (H:182-272) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltl

Timeline for d1ldph1:

• d1ldph1 first appeared (with stable ids) in SCOP 1.55
  
• d1ldph1 appears in SCOP 1.71
  
• d1ldph1 appears in SCOP 1.75
  
• d1ldph1 appears in the current release, SCOPe 2.08