Lineage for d3auvd1 (3auv D:11-118)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366710Domain d3auvd1: 3auv D:11-118 [208384]
    automated match to d1dzba2

Details for d3auvd1

PDB Entry: 3auv (more details), 2.4 Å

PDB Description: Predicting Amino Acid Preferences in the Complementarity Determining Regions of an Antibody-Antigen Recognition Interface
PDB Compounds: (D:) sc-dsFv derived from the G6-Fab

SCOPe Domain Sequences for d3auvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3auvd1 b.1.1.0 (D:11-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdiqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvp
srfsgsgsgtdftltisslqpedfatyycqqhyttpptfgcgtkveik

SCOPe Domain Coordinates for d3auvd1:

Click to download the PDB-style file with coordinates for d3auvd1.
(The format of our PDB-style files is described here.)

Timeline for d3auvd1: